Lineage for d1axib1 (1axi B:32-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761922Protein Growth hormone receptor [49280] (1 species)
  7. 2761923Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
    tandem of fibronectin type III domains
  8. 2761924Domain d1axib1: 1axi B:32-130 [21997]
    Other proteins in same PDB: d1axia_
    complexed with so4

Details for d1axib1

PDB Entry: 1axi (more details), 2.1 Å

PDB Description: structural plasticity at the hgh:hghbp interface
PDB Compounds: (B:) growth hormone receptor

SCOPe Domain Sequences for d1axib1:

Sequence, based on SEQRES records: (download)

>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
epkftkcrsperetfschwtdevhhgtknegpiqlfytrrntqewtqewkecpdyvsage
nscyfnssftsiaipycikltsnggtvdekcfsvdeivq

Sequence, based on observed residues (ATOM records): (download)

>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
epkftkcrsperetfschwtdegpiqlfytrrnewkecpdyvsagenscyfnssftsiai
pycikltsnggtvdekcfsvdeivq

SCOPe Domain Coordinates for d1axib1:

Click to download the PDB-style file with coordinates for d1axib1.
(The format of our PDB-style files is described here.)

Timeline for d1axib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axib2
View in 3D
Domains from other chains:
(mouse over for more information)
d1axia_