SCOPe 2.03: Domain d4drib_: 4dri B:

Lineage for d4drib_ (4dri B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family)
   automatically mapped to Pfam PF08771

5. Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)

6. Protein automated matches [193175] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193176] (3 PDB entries)

8. Domain d4drib_: 4dri B: [219969]
   Other proteins in same PDB: d4dria_
   automated match to d4drhe_
   complexed with rap

Details for d4drib_

PDB Entry: 4dri, 1.45 Å

PDB Description: Co-crystal structure of the PPIase domain of FKBP51, Rapamycin and the FRB fragment of mTOR

PDB Compounds: (B:) Serine/threonine-protein kinase mTOR

SCOPe Domain Sequences for d4drib_:

Sequence; same for both SEQRES and ATOM records:

>d4drib_ a.24.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamdpefmemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygr
dlmeaqewcrkymksgnvkdltqawdlyyhvfrris

Timeline for d4drib_:

• d4drib_ is new in SCOPe 2.03-stable
  
• d4drib_ appears in SCOPe 2.04
  
• d4drib_ appears in the current release, SCOPe 2.08, called d4drib1