Lineage for d4dr9d_ (4dr9 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3001128Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 3001129Protein automated matches [191055] (20 species)
    not a true protein
  7. 3001212Species Synechococcus elongatus [TaxId:269084] [226557] (2 PDB entries)
  8. 3001220Domain d4dr9d_: 4dr9 D: [219967]
    automated match to d1veza_
    complexed with bb2, br, zn

Details for d4dr9d_

PDB Entry: 4dr9 (more details), 1.9 Å

PDB Description: crystal structure of a peptide deformylase from synechococcus elongatus in complex with actinonin
PDB Compounds: (D:) Peptide deformylase

SCOPe Domain Sequences for d4dr9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dr9d_ d.167.1.0 (D:) automated matches {Synechococcus elongatus [TaxId: 269084]}
vairvakkklakppldlhylgdrvlrqpakrvsriddelrqtirqmlqtmysadgiglaa
pqvginkqlividleledeqapplvlinpkiertagdleqcqegclsipgvyldverpei
vevsykdengrpqrlvadgllarciqhemdhlngvlfvdrvenrlelnealdkkgfavqa
vrpv

SCOPe Domain Coordinates for d4dr9d_:

Click to download the PDB-style file with coordinates for d4dr9d_.
(The format of our PDB-style files is described here.)

Timeline for d4dr9d_: