Lineage for d4dqxc1 (4dqx C:23-276)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095817Species Rhizobium etli [TaxId:347834] [226316] (3 PDB entries)
  8. 2095826Domain d4dqxc1: 4dqx C:23-276 [219960]
    Other proteins in same PDB: d4dqxa2, d4dqxc2, d4dqxd2
    automated match to d2c07a1

Details for d4dqxc1

PDB Entry: 4dqx (more details), 2 Å

PDB Description: crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42
PDB Compounds: (C:) Probable oxidoreductase protein

SCOPe Domain Sequences for d4dqxc1:

Sequence, based on SEQRES records: (download)

>d4dqxc1 c.2.1.0 (C:23-276) automated matches {Rhizobium etli [TaxId: 347834]}
mdlnqrvcivtgggsgigrataelfakngayvvvadvnedaavrvaneigskafgvrvdv
ssakdaesmvekttakwgrvdvlvnnagfgttgnvvtipeetwdrimsvnvkgiflcsky
vipvmrrngggsiinttsytatsaiadrtayvaskgaissltramamdhakegirvnava
pgtidspyftkifaeakdpaklrsdfnaravmdrmgtaeeiaeamlflasdrsrfatgsi
ltvdggssignhlv

Sequence, based on observed residues (ATOM records): (download)

>d4dqxc1 c.2.1.0 (C:23-276) automated matches {Rhizobium etli [TaxId: 347834]}
mdlnqrvcivtgggsgigrataelfakngayvvvadvnedaavrvaneigskafgvrvdv
ssakdaesmvekttakwgrvdvlvnnagfgttgnvvtipeetwdrimsvnvkgiflcsky
vipvmrrngggsiinttsytatsaiadrtayvaskgaissltramamdhakegirvnava
pgtidspyftkifpaklrsdfnaravmdrmgtaeeiaeamlflasdrsrfatgsiltvdg
gssignhlv

SCOPe Domain Coordinates for d4dqxc1:

Click to download the PDB-style file with coordinates for d4dqxc1.
(The format of our PDB-style files is described here.)

Timeline for d4dqxc1: