| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Rhizobium etli [TaxId:347834] [226316] (3 PDB entries) |
| Domain d4dqxa1: 4dqx A:23-276 [219958] Other proteins in same PDB: d4dqxa2, d4dqxc2, d4dqxd2 automated match to d2c07a1 |
PDB Entry: 4dqx (more details), 2 Å
SCOPe Domain Sequences for d4dqxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dqxa1 c.2.1.0 (A:23-276) automated matches {Rhizobium etli [TaxId: 347834]}
mdlnqrvcivtgggsgigrataelfakngayvvvadvnedaavrvaneigskafgvrvdv
ssakdaesmvekttakwgrvdvlvnnagfgttgnvvtipeetwdrimsvnvkgiflcsky
vipvmrrngggsiinttsytatsaiadrtayvaskgaissltramamdhakegirvnava
pgtidspyftkifaeakdpaklrsdfnaravmdrmgtaeeiaeamlflasdrsrfatgsi
ltvdggssignhlv
Timeline for d4dqxa1: