Lineage for d4dqxa1 (4dqx A:23-276)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848316Species Rhizobium etli [TaxId:347834] [226316] (3 PDB entries)
  8. 2848323Domain d4dqxa1: 4dqx A:23-276 [219958]
    Other proteins in same PDB: d4dqxa2, d4dqxc2, d4dqxd2
    automated match to d2c07a1

Details for d4dqxa1

PDB Entry: 4dqx (more details), 2 Å

PDB Description: crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42
PDB Compounds: (A:) Probable oxidoreductase protein

SCOPe Domain Sequences for d4dqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dqxa1 c.2.1.0 (A:23-276) automated matches {Rhizobium etli [TaxId: 347834]}
mdlnqrvcivtgggsgigrataelfakngayvvvadvnedaavrvaneigskafgvrvdv
ssakdaesmvekttakwgrvdvlvnnagfgttgnvvtipeetwdrimsvnvkgiflcsky
vipvmrrngggsiinttsytatsaiadrtayvaskgaissltramamdhakegirvnava
pgtidspyftkifaeakdpaklrsdfnaravmdrmgtaeeiaeamlflasdrsrfatgsi
ltvdggssignhlv

SCOPe Domain Coordinates for d4dqxa1:

Click to download the PDB-style file with coordinates for d4dqxa1.
(The format of our PDB-style files is described here.)

Timeline for d4dqxa1: