Lineage for d4dqrd2 (4dqr D:469-876)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016762Protein automated matches [226972] (9 species)
    not a true protein
  7. 3016788Species Geobacillus kaustophilus [TaxId:235909] [226400] (6 PDB entries)
  8. 3016799Domain d4dqrd2: 4dqr D:469-876 [219957]
    Other proteins in same PDB: d4dqra1, d4dqrd1
    automated match to d2hhva2
    protein/DNA complex; complexed with ctp, mn, mpd, so4

Details for d4dqrd2

PDB Entry: 4dqr (more details), 1.95 Å

PDB Description: Ternary complex of Bacillus DNA Polymerase I Large Fragment E658A, DNA duplex, and rCTP (paired with dG of template) in presence of Mn2+
PDB Compounds: (D:) DNA polymerase

SCOPe Domain Sequences for d4dqrd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dqrd2 e.8.1.1 (D:469-876) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpatkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqialrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOPe Domain Coordinates for d4dqrd2:

Click to download the PDB-style file with coordinates for d4dqrd2.
(The format of our PDB-style files is described here.)

Timeline for d4dqrd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dqrd1