SCOPe 2.03: Domain d4dqra1: 4dqr A:297-468

Lineage for d4dqra1 (4dqr A:297-468)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (20 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [226399] (5 PDB entries)

8. Domain d4dqra1: 4dqr A:297-468 [219954]
   Other proteins in same PDB: d4dqra2, d4dqrd2
   automated match to d1nk4a1
   protein/DNA complex; complexed with ctp, mn, mpd, so4

Details for d4dqra1

PDB Entry: 4dqr, 1.95 Å

PDB Description: Ternary complex of Bacillus DNA Polymerase I Large Fragment E658A, DNA duplex, and rCTP (paired with dG of template) in presence of Mn2+

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4dqra1:

Sequence; same for both SEQRES and ATOM records:

>d4dqra1 c.55.3.0 (A:297-468) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d4dqra1:

• d4dqra1 is new in SCOPe 2.03-stable
  
• d4dqra1 appears in SCOPe 2.04
  
• d4dqra1 appears in the current release, SCOPe 2.08