Lineage for d1qg3b1 (1qg3 B:1127-1217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761968Protein Integrin beta-4 subunit [49278] (1 species)
  7. 2761969Species Human (Homo sapiens) [TaxId:9606] [49279] (3 PDB entries)
  8. 2761976Domain d1qg3b1: 1qg3 B:1127-1217 [21995]
    first tandem pair of FnIII domains
    complexed with cac, so4

Details for d1qg3b1

PDB Entry: 1qg3 (more details), 2.15 Å

PDB Description: crystal structure of a tandem pair of fibronectin type iii domains from the cytoplasmic tail of integrin alpha6 beta4
PDB Compounds: (B:) protein (integrin beta-4 subunit)

SCOPe Domain Sequences for d1qg3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qg3b1 b.1.2.1 (B:1127-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}
lgapqnpnakaagsrkihfnwlppsgkpmgyrvkywiqgdseseahlldskvpsveltnl
ypycdyemkvcaygaqgegpysslvscrthq

SCOPe Domain Coordinates for d1qg3b1:

Click to download the PDB-style file with coordinates for d1qg3b1.
(The format of our PDB-style files is described here.)

Timeline for d1qg3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qg3b2