SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4dqla1 (4dql A:661-887)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054836Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2054837Protein automated matches [226870] (20 species)
    not a true protein
  7. 2054840Species Bacillus megaterium [TaxId:1404] [226322] (2 PDB entries)
  8. 2054841Domain d4dqla1: 4dql A:661-887 [219940]
    Other proteins in same PDB: d4dqla2, d4dqlb2
    automated match to d1tlla1
    complexed with 1pe, fad, nap, pg4, so4

Details for d4dqla1

PDB Entry: 4dql (more details), 2.15 Å

PDB Description: Crystal structure of the FAD binding domain of cytochrome P450 BM3 in complex with NADP+
PDB Compounds: (A:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d4dqla1:

Sequence, based on SEQRES records: (download)

>d4dqla1 b.43.4.0 (A:661-887) automated matches {Bacillus megaterium [TaxId: 1404]}
gafstnvvaskelqqpgsarstrhleielpkeasyqegdhlgviprnyegivnrvtarfg
ldasqqirleaeeeklahlplaktvsveellqyvelqdpvtrtqlramaaktvcpphkve
leallekqaykeqvlakrltmlellekypacemkfsefiallpsirpryysisssprvde
kqasitvsvvsgeawsgygeykgiasnylaelqegdtitcfistpqs

Sequence, based on observed residues (ATOM records): (download)

>d4dqla1 b.43.4.0 (A:661-887) automated matches {Bacillus megaterium [TaxId: 1404]}
gafstnvvaskelqqpgsarstrhleielpkeasyqegdhlgviprnyegivnrvtarfg
ldasqqirleaktvsveellqyvelqdpvtrtqlramaaktvcpphkveleallekqayk
eqvlakrltmlellekypacemkfsefiallpsirpryysisssprvdekqasitvsvvs
geawsgygeykgiasnylaelqegdtitcfistpqs

SCOPe Domain Coordinates for d4dqla1:

Click to download the PDB-style file with coordinates for d4dqla1.
(The format of our PDB-style files is described here.)

Timeline for d4dqla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dqla2