![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Integrin beta-4 subunit [49278] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49279] (3 PDB entries) |
![]() | Domain d1qg3a2: 1qg3 A:1218-1320 [21994] first tandem pair of FnIII domains complexed with cac, so4 |
PDB Entry: 1qg3 (more details), 2.15 Å
SCOPe Domain Sequences for d1qg3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} evpsepgrlafnvvsstvtqlswaepaetngeitayevcyglvnddnrpigpmkkvlvdn pknrmllienlresqpyrytvkarngagwgpereaiinlatqp
Timeline for d1qg3a2: