Lineage for d4dqkb1 (4dqk B:660-887)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793676Species Bacillus megaterium [TaxId:1404] [226322] (2 PDB entries)
  8. 2793680Domain d4dqkb1: 4dqk B:660-887 [219938]
    Other proteins in same PDB: d4dqka2, d4dqkb2
    automated match to d1tlla1
    complexed with fad, pg4, so4

Details for d4dqkb1

PDB Entry: 4dqk (more details), 2.4 Å

PDB Description: Crystal structure of the FAD binding domain of cytochrome P450 BM3
PDB Compounds: (B:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d4dqkb1:

Sequence, based on SEQRES records: (download)

>d4dqkb1 b.43.4.0 (B:660-887) automated matches {Bacillus megaterium [TaxId: 1404]}
hgafstnvvaskelqqpgsarstrhleielpkeasyqegdhlgviprnyegivnrvtarf
gldasqqirleaeeeklahlplaktvsveellqyvelqdpvtrtqlramaaktvapphkv
eleallekqaykeqvlakrltmlellekypacemkfsefiallpsirpryysisssprvd
ekqasitvsvvsgeawsgygeykgiasnylaelqegdtitcfistpqs

Sequence, based on observed residues (ATOM records): (download)

>d4dqkb1 b.43.4.0 (B:660-887) automated matches {Bacillus megaterium [TaxId: 1404]}
hgafstnvvaskelqqpgsarstrhleielpkeasyqegdhlgviprnyegivnrvtarf
gldasqqirlektvsveellqyvelqdpvtrtqlramaaktvapphkveleallekqayk
eqvlakrltmlellekypacemkfsefiallpsirpryysisssprvdekqasitvsvvs
geawsgygeykgiasnylaelqegdtitcfistpqs

SCOPe Domain Coordinates for d4dqkb1:

Click to download the PDB-style file with coordinates for d4dqkb1.
(The format of our PDB-style files is described here.)

Timeline for d4dqkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dqkb2