Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (22 species) not a true protein |
Species Bacillus megaterium [TaxId:1404] [226322] (2 PDB entries) |
Domain d4dqkb1: 4dqk B:660-887 [219938] Other proteins in same PDB: d4dqka2, d4dqkb2 automated match to d1tlla1 complexed with fad, pg4, so4 |
PDB Entry: 4dqk (more details), 2.4 Å
SCOPe Domain Sequences for d4dqkb1:
Sequence, based on SEQRES records: (download)
>d4dqkb1 b.43.4.0 (B:660-887) automated matches {Bacillus megaterium [TaxId: 1404]} hgafstnvvaskelqqpgsarstrhleielpkeasyqegdhlgviprnyegivnrvtarf gldasqqirleaeeeklahlplaktvsveellqyvelqdpvtrtqlramaaktvapphkv eleallekqaykeqvlakrltmlellekypacemkfsefiallpsirpryysisssprvd ekqasitvsvvsgeawsgygeykgiasnylaelqegdtitcfistpqs
>d4dqkb1 b.43.4.0 (B:660-887) automated matches {Bacillus megaterium [TaxId: 1404]} hgafstnvvaskelqqpgsarstrhleielpkeasyqegdhlgviprnyegivnrvtarf gldasqqirlektvsveellqyvelqdpvtrtqlramaaktvapphkveleallekqayk eqvlakrltmlellekypacemkfsefiallpsirpryysisssprvdekqasitvsvvs geawsgygeykgiasnylaelqegdtitcfistpqs
Timeline for d4dqkb1: