Lineage for d4dqka2 (4dqk A:888-1048)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118600Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2118601Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2118771Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2118772Protein automated matches [226871] (18 species)
    not a true protein
  7. 2118777Species Bacillus megaterium [TaxId:1404] [226323] (2 PDB entries)
  8. 2118780Domain d4dqka2: 4dqk A:888-1048 [219937]
    Other proteins in same PDB: d4dqka1, d4dqkb1
    automated match to d1tlla3
    complexed with fad, pg4, so4

Details for d4dqka2

PDB Entry: 4dqk (more details), 2.4 Å

PDB Description: Crystal structure of the FAD binding domain of cytochrome P450 BM3
PDB Compounds: (A:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d4dqka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dqka2 c.25.1.0 (A:888-1048) automated matches {Bacillus megaterium [TaxId: 1404]}
eftlpkdpetplimvgpgtgvapfrgfvqarkqlkeqgqslgeahlyfgcrsphedylyq
eelenaqsegiitlhtafsrmpnqpktyvqhvmeqdgkklielldqgahfyicgdgsqma
paveatlmksyadvhqvseadarlwlqqleekgryakdvwa

SCOPe Domain Coordinates for d4dqka2:

Click to download the PDB-style file with coordinates for d4dqka2.
(The format of our PDB-style files is described here.)

Timeline for d4dqka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dqka1