| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
| Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
| Protein automated matches [226871] (19 species) not a true protein |
| Species Bacillus megaterium [TaxId:1404] [226323] (2 PDB entries) |
| Domain d4dqka2: 4dqk A:888-1048 [219937] Other proteins in same PDB: d4dqka1, d4dqkb1 automated match to d1tlla3 complexed with fad, pg4, so4 |
PDB Entry: 4dqk (more details), 2.4 Å
SCOPe Domain Sequences for d4dqka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dqka2 c.25.1.0 (A:888-1048) automated matches {Bacillus megaterium [TaxId: 1404]}
eftlpkdpetplimvgpgtgvapfrgfvqarkqlkeqgqslgeahlyfgcrsphedylyq
eelenaqsegiitlhtafsrmpnqpktyvqhvmeqdgkklielldqgahfyicgdgsqma
paveatlmksyadvhqvseadarlwlqqleekgryakdvwa
Timeline for d4dqka2: