Lineage for d4dq8b2 (4dq8 B:187-385)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885373Species Mycobacterium marinum [TaxId:216594] [226310] (1 PDB entry)
  8. 2885377Domain d4dq8b2: 4dq8 B:187-385 [219931]
    automated match to d1g99a2

Details for d4dq8b2

PDB Entry: 4dq8 (more details), 2.25 Å

PDB Description: crystal structure of acetate kinase acka from mycobacterium marinum
PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d4dq8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dq8b2 c.55.1.0 (B:187-385) automated matches {Mycobacterium marinum [TaxId: 216594]}
pigdlnqivlhlgngasasavaggrpvetsmgltpleglvmgtrsgdldpgvigylwrta
klgvdeiesmlnhrsgmlglagerdfrrlramiddgdpaaelaydvfihrlrkyvgayla
vlghtdvvsftagigehdaavrrdtlagmaelgislderrnacpsggarrisaddspvtv
lviptneelaiarhccsvl

SCOPe Domain Coordinates for d4dq8b2:

Click to download the PDB-style file with coordinates for d4dq8b2.
(The format of our PDB-style files is described here.)

Timeline for d4dq8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dq8b1