SCOPe 2.06: Domain d1qg3a1: 1qg3 A:1126-1217

Lineage for d1qg3a1 (1qg3 A:1126-1217)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Integrin beta-4 subunit [49278] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49279] (3 PDB entries)

8. Domain d1qg3a1: 1qg3 A:1126-1217 [21993]
   first tandem pair of FnIII domains
   complexed with cac, so4

Details for d1qg3a1

PDB Entry: 1qg3, 2.15 Å

PDB Description: crystal structure of a tandem pair of fibronectin type iii domains from the cytoplasmic tail of integrin alpha6 beta4

PDB Compounds: (A:) protein (integrin beta-4 subunit)

SCOPe Domain Sequences for d1qg3a1:

Sequence; same for both SEQRES and ATOM records:

>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}
dlgapqnpnakaagsrkihfnwlppsgkpmgyrvkywiqgdseseahlldskvpsveltn
lypycdyemkvcaygaqgegpysslvscrthq

Timeline for d1qg3a1:

• d1qg3a1 first appeared (with stable ids) in SCOP 1.55
  
• d1qg3a1 appears in SCOPe 2.05
  
• d1qg3a1 appears in SCOPe 2.07
  
• d1qg3a1 appears in the current release, SCOPe 2.08