SCOPe 2.03: Domain d4dq8a1: 4dq8 A:7-186

Lineage for d4dq8a1 (4dq8 A:7-186)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Mycobacterium marinum [TaxId:216594] [226310] (1 PDB entry)

8. Domain d4dq8a1: 4dq8 A:7-186 [219928]
   automated match to d1g99a1

Details for d4dq8a1

PDB Entry: 4dq8, 2.25 Å

PDB Description: crystal structure of acetate kinase acka from mycobacterium marinum

PDB Compounds: (A:) acetate kinase

SCOPe Domain Sequences for d4dq8a1:

Sequence, based on SEQRES records:

>d4dq8a1 c.55.1.0 (A:7-186) automated matches {Mycobacterium marinum [TaxId: 216594]}
nrvvlvlnsgssslkfqlvepdsgmsratgnierigeesssvpdhdaalrrvfeilaedd
idlqscglvavghrvvhggkdfyeptllndavigkldelsplaplhnppavlcirvaral
lpdvphiavfdtaffhqlppaaatyaidreladvwkirrygfhgtsheyvsqqaaeflgk

Sequence, based on observed residues (ATOM records):

>d4dq8a1 c.55.1.0 (A:7-186) automated matches {Mycobacterium marinum [TaxId: 216594]}
nrvvlvlnsgssslkfqlvepdsgmsratgnieripdhdaalrrvfeilaeddidlqscg
lvavghrvvhggkdfyeptllndavigkldelsplaplhnppavlcirvarallpdvphi
avfdtaffhqlppaaatyaidreladvwkirrygfhgtsheyvsqqaaeflgk

Timeline for d4dq8a1:

• d4dq8a1 is new in SCOPe 2.03-stable
  
• d4dq8a1 appears in SCOPe 2.04
  
• d4dq8a1 appears in the current release, SCOPe 2.08