Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (35 species) not a true protein |
Species Mycobacterium marinum [TaxId:216594] [226310] (1 PDB entry) |
Domain d4dq8a1: 4dq8 A:7-186 [219928] automated match to d1g99a1 |
PDB Entry: 4dq8 (more details), 2.25 Å
SCOPe Domain Sequences for d4dq8a1:
Sequence, based on SEQRES records: (download)
>d4dq8a1 c.55.1.0 (A:7-186) automated matches {Mycobacterium marinum [TaxId: 216594]} nrvvlvlnsgssslkfqlvepdsgmsratgnierigeesssvpdhdaalrrvfeilaedd idlqscglvavghrvvhggkdfyeptllndavigkldelsplaplhnppavlcirvaral lpdvphiavfdtaffhqlppaaatyaidreladvwkirrygfhgtsheyvsqqaaeflgk
>d4dq8a1 c.55.1.0 (A:7-186) automated matches {Mycobacterium marinum [TaxId: 216594]} nrvvlvlnsgssslkfqlvepdsgmsratgnieripdhdaalrrvfeilaeddidlqscg lvavghrvvhggkdfyeptllndavigkldelsplaplhnppavlcirvarallpdvphi avfdtaffhqlppaaatyaidreladvwkirrygfhgtsheyvsqqaaeflgk
Timeline for d4dq8a1: