Class b: All beta proteins [48724] (176 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins) |
Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63740] (45 PDB entries) Uniprot P09960 |
Domain d4dpra1: 4dpr A:4-208 [219925] Other proteins in same PDB: d4dpra2, d4dpra3 automated match to d1hs6a2 complexed with acy, gol, x8z, yb, zn |
PDB Entry: 4dpr (more details), 2.02 Å
SCOPe Domain Sequences for d4dpra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dpra1 b.98.1.1 (A:4-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped psrkiykfiqkvpipcylialvvga
Timeline for d4dpra1: