Lineage for d4dpoa_ (4dpo A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907207Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1907208Protein automated matches [190081] (21 species)
    not a true protein
  7. 1907286Species Methanosarcina mazei [TaxId:192952] [226315] (1 PDB entry)
  8. 1907287Domain d4dpoa_: 4dpo A: [219923]
    automated match to d1x7vc_

Details for d4dpoa_

PDB Entry: 4dpo (more details), 2.73 Å

PDB Description: crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1
PDB Compounds: (A:) conserved protein

SCOPe Domain Sequences for d4dpoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dpoa_ d.58.4.0 (A:) automated matches {Methanosarcina mazei [TaxId: 192952]}
nlyfqsmlairvvaknqvkpekvqefmnlckslieetlkeegcidygvyqelenpeiltm
leewkdegsldqhirsdhfkeifpllsecldketeiniyrkk

SCOPe Domain Coordinates for d4dpoa_:

Click to download the PDB-style file with coordinates for d4dpoa_.
(The format of our PDB-style files is described here.)

Timeline for d4dpoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4dpob_