Lineage for d4dpnd_ (4dpn D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042822Species Canavalia lineata [TaxId:28957] [193321] (5 PDB entries)
  8. 2042826Domain d4dpnd_: 4dpn D: [219922]
    automated match to d2cwma_
    complexed with ca, mn, stl

Details for d4dpnd_

PDB Entry: 4dpn (more details), 2.55 Å

PDB Description: Crystal Structure of ConM Complexed with Resveratrol
PDB Compounds: (D:) Concanavalin-A

SCOPe Domain Sequences for d4dpnd_:

Sequence, based on SEQRES records: (download)

>d4dpnd_ b.29.1.1 (D:) automated matches {Canavalia lineata [TaxId: 28957]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d4dpnd_ b.29.1.1 (D:) automated matches {Canavalia lineata [TaxId: 28957]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklktnal
hfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwessa
vvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d4dpnd_:

Click to download the PDB-style file with coordinates for d4dpnd_.
(The format of our PDB-style files is described here.)

Timeline for d4dpnd_: