Lineage for d1cfb_2 (1cfb 710-814)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (14 proteins) 
Protein Neuroglian, two amino proximal Fn3 repeats [49276] (1 species) Species Drosophila melanogaster [TaxId:7227] [49277] (1 PDB entry) 
Domain d1cfb_2: 1cfb 710-814 [21992]
Details for d1cfb_2
PDB Entry: 1cfb (more details), 2 Å
PDB Description: crystal structure of tandem type iii fibronectin domains from drosophila neuroglian at 2.0 angstroms
SCOP Domain Sequences for d1cfb_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfb_2 b.1.2.1 (710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster}
pdvpfknpdnvvgqgtepnnlviswtpmpeiehnapnfhyyvswkrdipaaawennnifd
wrqnniviadqptfvkylikvvaindrgesnvaaeevvgysgedr
SCOP Domain Coordinates for d1cfb_2:
Click to download the PDB-style file with coordinates for d1cfb_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cfb_2:
- d1cfb_2 appears in SCOP 1.57
- d1cfb_2 appears in the current release, SCOPe 2.08, called d1cfba2
View in 3D
