Lineage for d4dpgb2 (4dpg B:222-576)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208934Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2208935Protein automated matches [226887] (13 species)
    not a true protein
  7. 2208972Species Human (Homo sapiens) [TaxId:9606] [225403] (8 PDB entries)
  8. 2208984Domain d4dpgb2: 4dpg B:222-576 [219908]
    Other proteins in same PDB: d4dpga1, d4dpgb1, d4dpgc1, d4dpgd1, d4dpge1, d4dpgf1, d4dpgg1, d4dpgh1
    automated match to d1bbua2
    protein/RNA complex; complexed with ala, apc, lys, mg

Details for d4dpgb2

PDB Entry: 4dpg (more details), 2.84 Å

PDB Description: crystal structure of human lysrs: p38/aimp2 complex i
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4dpgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dpgb2 d.104.1.0 (B:222-576) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkpe

SCOPe Domain Coordinates for d4dpgb2:

Click to download the PDB-style file with coordinates for d4dpgb2.
(The format of our PDB-style files is described here.)

Timeline for d4dpgb2: