Lineage for d4dp9x_ (4dp9 X:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1302648Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1303001Protein Plastocyanin [49507] (16 species)
  7. 1303049Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (16 PDB entries)
  8. 1303051Domain d4dp9x_: 4dp9 X: [219902]
    automated match to d1plca_
    complexed with cu

Details for d4dp9x_

PDB Entry: 4dp9 (more details), 1 Å

PDB Description: the 1.00 angstrom crystal structure of oxidized (cuii) poplar plastocyanin a at ph 6.0
PDB Compounds: (X:) Plastocyanin A, chloroplastic

SCOPe Domain Sequences for d4dp9x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dp9x_ b.6.1.1 (X:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn

SCOPe Domain Coordinates for d4dp9x_:

Click to download the PDB-style file with coordinates for d4dp9x_.
(The format of our PDB-style files is described here.)

Timeline for d4dp9x_: