SCOPe 2.06: Domain d4dp2x_: 4dp2 X:

Lineage for d4dp2x_ (4dp2 X:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein automated matches [190545] (8 species)
   not a true protein

7. Species Populus nigra [TaxId:3691] [194010] (6 PDB entries)

8. Domain d4dp2x_: 4dp2 X: [219898]
   automated match to d4dp4x_
   complexed with act, cu, gol, so4

Details for d4dp2x_

PDB Entry: 4dp2, 1.8 Å

PDB Description: the 1.8 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 6.0

PDB Compounds: (X:) Plastocyanin B, chloroplastic

SCOPe Domain Sequences for d4dp2x_:

Sequence; same for both SEQRES and ATOM records:

>d4dp2x_ b.6.1.1 (X:) automated matches {Populus nigra [TaxId: 3691]}
vdvllgaddgslafvpsefsvpagekivfknnagfphnvlfdedavpsgvdvskismsee
dllnakgetfevalsdkgeytfycsphqgagmvgkvivn

Timeline for d4dp2x_:

• d4dp2x_ first appeared in SCOPe 2.03
  
• d4dp2x_ appears in SCOPe 2.05
  
• d4dp2x_ appears in SCOPe 2.07
  
• d4dp2x_ appears in the current release, SCOPe 2.08