Lineage for d4dp2x_ (4dp2 X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770993Protein automated matches [190545] (9 species)
    not a true protein
  7. 2771016Species Populus nigra [TaxId:3691] [194010] (6 PDB entries)
  8. 2771021Domain d4dp2x_: 4dp2 X: [219898]
    automated match to d4dp4x_
    complexed with act, cu, gol, so4

Details for d4dp2x_

PDB Entry: 4dp2 (more details), 1.8 Å

PDB Description: the 1.8 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 6.0
PDB Compounds: (X:) Plastocyanin B, chloroplastic

SCOPe Domain Sequences for d4dp2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dp2x_ b.6.1.1 (X:) automated matches {Populus nigra [TaxId: 3691]}
vdvllgaddgslafvpsefsvpagekivfknnagfphnvlfdedavpsgvdvskismsee
dllnakgetfevalsdkgeytfycsphqgagmvgkvivn

SCOPe Domain Coordinates for d4dp2x_:

Click to download the PDB-style file with coordinates for d4dp2x_.
(The format of our PDB-style files is described here.)

Timeline for d4dp2x_: