![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein automated matches [190545] (9 species) not a true protein |
![]() | Species Populus nigra [TaxId:3691] [194010] (6 PDB entries) |
![]() | Domain d4dp0x_: 4dp0 X: [219896] automated match to d4dp4x_ complexed with cu, gol, so4 |
PDB Entry: 4dp0 (more details), 1.5 Å
SCOPe Domain Sequences for d4dp0x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dp0x_ b.6.1.1 (X:) automated matches {Populus nigra [TaxId: 3691]} vdvllgaddgslafvpsefsvpagekivfknnagfphnvlfdedavpsgvdvskismsee dllnakgetfevalsdkgeytfycsphqgagmvgkvivn
Timeline for d4dp0x_: