Lineage for d4do5b2 (4do5 B:310-417)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804620Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1804621Protein automated matches [226835] (30 species)
    not a true protein
  7. 1804673Species Human (Homo sapiens) [TaxId:9606] [225771] (13 PDB entries)
  8. 1804677Domain d4do5b2: 4do5 B:310-417 [219891]
    Other proteins in same PDB: d4do5a1, d4do5b1
    automated match to d1ktba1
    complexed with cit, dgj, gol, nag

Details for d4do5b2

PDB Entry: 4do5 (more details), 1.51 Å

PDB Description: pharmacological chaperones for human alpha-n-acetylgalactosaminidase
PDB Compounds: (B:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d4do5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4do5b2 b.71.1.0 (B:310-417) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq
dvysgdiisglrdetnftviinpsgvvmwylypiknlemsqqhhhhhh

SCOPe Domain Coordinates for d4do5b2:

Click to download the PDB-style file with coordinates for d4do5b2.
(The format of our PDB-style files is described here.)

Timeline for d4do5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4do5b1