Lineage for d4do5b1 (4do5 B:18-309)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339758Protein automated matches [190099] (14 species)
    not a true protein
  7. 1339775Species Human (Homo sapiens) [TaxId:9606] [225770] (7 PDB entries)
  8. 1339779Domain d4do5b1: 4do5 B:18-309 [219890]
    Other proteins in same PDB: d4do5a2, d4do5b2
    automated match to d1ktba2
    complexed with cit, dgj, gol, nag

Details for d4do5b1

PDB Entry: 4do5 (more details), 1.51 Å

PDB Description: pharmacological chaperones for human alpha-n-acetylgalactosaminidase
PDB Compounds: (B:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d4do5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4do5b1 c.1.8.1 (B:18-309) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdp

SCOPe Domain Coordinates for d4do5b1:

Click to download the PDB-style file with coordinates for d4do5b1.
(The format of our PDB-style files is described here.)

Timeline for d4do5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4do5b2