Lineage for d1qr4b2 (1qr4 B:88-175)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54888Protein Tenascin [49273] (2 species)
  7. 54889Species Chicken (Gallus gallus) [TaxId:9031] [49274] (1 PDB entry)
  8. 54893Domain d1qr4b2: 1qr4 B:88-175 [21989]

Details for d1qr4b2

PDB Entry: 1qr4 (more details), 2.55 Å

PDB Description: two fibronectin type-iii domain segment from chicken tenascin

SCOP Domain Sequences for d1qr4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr4b2 b.1.2.1 (B:88-175) Tenascin {Chicken (Gallus gallus)}
vgspkgisfsditensatvswtpprsrvdsyrvsyvpitggtpnvvtvdgsktrtklvkl
vpgvdynvniisvkgfeesepisgilkt

SCOP Domain Coordinates for d1qr4b2:

Click to download the PDB-style file with coordinates for d1qr4b2.
(The format of our PDB-style files is described here.)

Timeline for d1qr4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qr4b1