| Class b: All beta proteins [48724] (178 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
| Protein automated matches [226835] (41 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries) |
| Domain d4do5a2: 4do5 A:310-404 [219889] Other proteins in same PDB: d4do5a1, d4do5b1, d4do5b3 automated match to d1ktba1 complexed with bma, cit, dgj, gol, man, nag |
PDB Entry: 4do5 (more details), 1.51 Å
SCOPe Domain Sequences for d4do5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4do5a2 b.71.1.0 (A:310-404) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq
dvysgdiisglrdetnftviinpsgvvmwylypik
Timeline for d4do5a2: