SCOPe 2.04: Domain d4do5a2: 4do5 A:310-404

Lineage for d4do5a2 (4do5 A:310-404)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225771] (13 PDB entries)

8. Domain d4do5a2: 4do5 A:310-404 [219889]
   Other proteins in same PDB: d4do5a1, d4do5b1
   automated match to d1ktba1
   complexed with cit, dgj, gol, nag

Details for d4do5a2

PDB Entry: 4do5, 1.51 Å

PDB Description: pharmacological chaperones for human alpha-n-acetylgalactosaminidase

PDB Compounds: (A:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d4do5a2:

Sequence; same for both SEQRES and ATOM records:

>d4do5a2 b.71.1.0 (A:310-404) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq
dvysgdiisglrdetnftviinpsgvvmwylypik

Timeline for d4do5a2:

• d4do5a2 first appeared in SCOPe 2.03
  
• d4do5a2 appears in SCOPe 2.05
  
• d4do5a2 appears in the current release, SCOPe 2.08