Lineage for d4do5a2 (4do5 A:310-404)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811079Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries)
  8. 2811084Domain d4do5a2: 4do5 A:310-404 [219889]
    Other proteins in same PDB: d4do5a1, d4do5b1, d4do5b3
    automated match to d1ktba1
    complexed with cit, dgj, gol, nag

Details for d4do5a2

PDB Entry: 4do5 (more details), 1.51 Å

PDB Description: pharmacological chaperones for human alpha-n-acetylgalactosaminidase
PDB Compounds: (A:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d4do5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4do5a2 b.71.1.0 (A:310-404) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq
dvysgdiisglrdetnftviinpsgvvmwylypik

SCOPe Domain Coordinates for d4do5a2:

Click to download the PDB-style file with coordinates for d4do5a2.
(The format of our PDB-style files is described here.)

Timeline for d4do5a2: