Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225770] (13 PDB entries) |
Domain d4do4b1: 4do4 B:18-309 [219886] Other proteins in same PDB: d4do4a2, d4do4b2 automated match to d1ktba2 complexed with acy, cit, djn, gol, nag |
PDB Entry: 4do4 (more details), 1.4 Å
SCOPe Domain Sequences for d4do4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4do4b1 c.1.8.1 (B:18-309) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdp
Timeline for d4do4b1: