Lineage for d4do4b1 (4do4 B:18-309)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830420Species Human (Homo sapiens) [TaxId:9606] [225770] (14 PDB entries)
  8. 2830422Domain d4do4b1: 4do4 B:18-309 [219886]
    Other proteins in same PDB: d4do4a2, d4do4b2, d4do4b3
    automated match to d1ktba2
    complexed with acy, cit, djn, gol, nag

Details for d4do4b1

PDB Entry: 4do4 (more details), 1.4 Å

PDB Description: pharmacological chaperones for human alpha-n-acetylgalactosaminidase
PDB Compounds: (B:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d4do4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4do4b1 c.1.8.1 (B:18-309) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdp

SCOPe Domain Coordinates for d4do4b1:

Click to download the PDB-style file with coordinates for d4do4b1.
(The format of our PDB-style files is described here.)

Timeline for d4do4b1: