![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (30 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225771] (13 PDB entries) |
![]() | Domain d4do4a2: 4do4 A:310-404 [219885] Other proteins in same PDB: d4do4a1, d4do4b1 automated match to d1ktba1 complexed with acy, cit, djn, gol, nag |
PDB Entry: 4do4 (more details), 1.4 Å
SCOPe Domain Sequences for d4do4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4do4a2 b.71.1.0 (A:310-404) automated matches {Human (Homo sapiens) [TaxId: 9606]} lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq dvysgdiisglrdetnftviinpsgvvmwylypik
Timeline for d4do4a2: