Lineage for d4dnxa2 (4dnx A:174-396)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860766Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
    automatically mapped to Pfam PF01747
  6. 2860802Protein automated matches [226985] (2 species)
    not a true protein
  7. 2860803Species Allochromatium vinosum [TaxId:572477] [226589] (1 PDB entry)
  8. 2860804Domain d4dnxa2: 4dnx A:174-396 [219875]
    Other proteins in same PDB: d4dnxa1, d4dnxb1
    automated match to d1jhda2
    complexed with mes

Details for d4dnxa2

PDB Entry: 4dnx (more details), 1.6 Å

PDB Description: the structure of the atp sulfurylase from allochromatium vinosum in the open state
PDB Compounds: (A:) sulfate adenylyltransferase

SCOPe Domain Sequences for d4dnxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dnxa2 c.26.1.5 (A:174-396) automated matches {Allochromatium vinosum [TaxId: 572477]}
pdtfrtaveirheiqergwqkivafqtrnpmhraheelckmameaveadgvvihmllgql
kpgdipapvrdaairtmaelyfppntvmvtgygfdmlyagpreavlhayfrqnmgathfi
igrdhagvgdyygpfdaqtifddavptdvlaieifradntayskklgrvvmmrdapdhtp
ddfiqlsgtrvremlgqgeapppefsrpevaqilmdyyrslpq

SCOPe Domain Coordinates for d4dnxa2:

Click to download the PDB-style file with coordinates for d4dnxa2.
(The format of our PDB-style files is described here.)

Timeline for d4dnxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dnxa1