Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins) automatically mapped to Pfam PF01747 |
Protein automated matches [226985] (2 species) not a true protein |
Species Allochromatium vinosum [TaxId:572477] [226589] (1 PDB entry) |
Domain d4dnxa2: 4dnx A:174-396 [219875] Other proteins in same PDB: d4dnxa1, d4dnxb1 automated match to d1jhda2 complexed with mes |
PDB Entry: 4dnx (more details), 1.6 Å
SCOPe Domain Sequences for d4dnxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dnxa2 c.26.1.5 (A:174-396) automated matches {Allochromatium vinosum [TaxId: 572477]} pdtfrtaveirheiqergwqkivafqtrnpmhraheelckmameaveadgvvihmllgql kpgdipapvrdaairtmaelyfppntvmvtgygfdmlyagpreavlhayfrqnmgathfi igrdhagvgdyygpfdaqtifddavptdvlaieifradntayskklgrvvmmrdapdhtp ddfiqlsgtrvremlgqgeapppefsrpevaqilmdyyrslpq
Timeline for d4dnxa2: