Lineage for d4dnja_ (4dnj A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278214Species Rhodopseudomonas palustris [TaxId:258594] [225205] (2 PDB entries)
  8. 1278215Domain d4dnja_: 4dnj A: [219873]
    automated match to d4do1d_
    complexed with ann, cl, hem

Details for d4dnja_

PDB Entry: 4dnj (more details), 1.8 Å

PDB Description: The crystal structures of 4-methoxybenzoate bound CYP199A2
PDB Compounds: (A:) putative cytochrome P450

SCOPe Domain Sequences for d4dnja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dnja_ a.104.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
sqhgagvphlgidpfaldyfadpypeqetlreagpvvyldkwnvygvaryaevyavlndp
ltfcssrgvglsdfkkekpwrppslileadppahtrtravlskvlspatmkrlrdgfaaa
adakidellarggnidaiadlaeayplsvfpdamglkqegrenllpyaglvfnafgppne
lrqsaiersaphqayvaeqcqrpnlapggfgacihafsdtgeitpeeapllvrsllsagl
dttvngiaaavyclarfpdefarlradpslarnafeeavrfespvqtffrtttrdvelag
atigegekvlmflgsanrdprrwddpdryditrktsghvgfgsgvhmcvgqlvarlegev
vlaalarkvaaieiagplkrrfnntlrgleslpiqltpa

SCOPe Domain Coordinates for d4dnja_:

Click to download the PDB-style file with coordinates for d4dnja_.
(The format of our PDB-style files is described here.)

Timeline for d4dnja_: