Lineage for d4dnda_ (4dnd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323361Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2323374Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 2323375Family a.47.2.1: t-snare proteins [47662] (6 proteins)
  6. 2323399Protein automated matches [191190] (5 species)
    not a true protein
  7. 2323409Species Human (Homo sapiens) [TaxId:9606] [226308] (1 PDB entry)
  8. 2323410Domain d4dnda_: 4dnd A: [219872]
    automated match to d1lvfb_

Details for d4dnda_

PDB Entry: 4dnd (more details), 1.4 Å

PDB Description: Crystal structure of syntaxin 10 from Homo sapiens
PDB Compounds: (A:) Syntaxin-10

SCOPe Domain Sequences for d4dnda_:

Sequence, based on SEQRES records: (download)

>d4dnda_ a.47.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpffvvrgevqkavntarglyqrwcellqesaavgreeldwttnelrnglrsiewdledl
eetigiveanpgkfklpagdlqerkvfvermreavqemkdhmvs

Sequence, based on observed residues (ATOM records): (download)

>d4dnda_ a.47.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpffvvrgevqkavntarglyqrwceleeldwttnelrnglrsiewdledleetigivea
npgkfklpagdlqerkvfvermreavqemkdhmvs

SCOPe Domain Coordinates for d4dnda_:

Click to download the PDB-style file with coordinates for d4dnda_.
(The format of our PDB-style files is described here.)

Timeline for d4dnda_: