Lineage for d4dn8a1 (4dn8 A:235-355)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001752Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 3001803Species Pig (Sus scrofa) [TaxId:9823] [226409] (3 PDB entries)
  8. 3001806Domain d4dn8a1: 4dn8 A:235-355 [219871]
    automated match to d1pwba1
    complexed with bma, ca

Details for d4dn8a1

PDB Entry: 4dn8 (more details), 2.2 Å

PDB Description: structure of porcine surfactant protein d neck and carbohydrate recognition domain complexed with mannose
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d4dn8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dn8a1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Pig (Sus scrofa) [TaxId: 9823]}
pngrgvgekifktggfektfqdaqqvctqaggqmasprsetenealsqlvtaqnkaafls
mtdiktegqftyptgeplvyanwapgepnnnggssgaencveifpngkwndkacgelrlv
icef

SCOPe Domain Coordinates for d4dn8a1:

Click to download the PDB-style file with coordinates for d4dn8a1.
(The format of our PDB-style files is described here.)

Timeline for d4dn8a1: