SCOPe 2.05: Domain d4dn3l1: 4dn3 L:1-108

Lineage for d4dn3l1 (4dn3 L:1-108)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d4dn3l1: 4dn3 L:1-108 [219869]
   Other proteins in same PDB: d4dn3l2
   automated match to d1dn0a1

Details for d4dn3l1

PDB Entry: 4dn3, 2.6 Å

PDB Description: crystal structure of anti-mcp-1 antibody cnto888

PDB Compounds: (L:) cnto888 light chain

SCOPe Domain Sequences for d4dn3l1:

Sequence; same for both SEQRES and ATOM records:

>d4dn3l1 b.1.1.1 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvsdaylawyqqkpgqaprlliydassratgvp
arfsgsgsgtdftltisslepedfavyychqyiqlhsftfgqgtkvei

Timeline for d4dn3l1:

• d4dn3l1 first appeared in SCOPe 2.03
  
• d4dn3l1 appears in SCOPe 2.04
  
• d4dn3l1 appears in SCOPe 2.06
  
• d4dn3l1 appears in the current release, SCOPe 2.08