![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
![]() | Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
![]() | Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
![]() | Protein automated matches [190672] (21 species) not a true protein |
![]() | Species Geobacter metallireducens [TaxId:269799] [226309] (1 PDB entry) |
![]() | Domain d4dn2b_: 4dn2 B: [219868] automated match to d3bema_ complexed with fmn |
PDB Entry: 4dn2 (more details), 1.5 Å
SCOPe Domain Sequences for d4dn2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dn2b_ d.90.1.0 (B:) automated matches {Geobacter metallireducens [TaxId: 269799]} yfqsmetleairtrrsvrkfsdrpvepeklravldaarlapswanmqcwrfvvvedqatk vqiselsyveayfgpkgyksnpaqkalaeapvviiacgeppqsgelrgqqyyltdvgiaa qnlmlaahdlglgsvfvgvfdeqqlgellgipaelrivglfplgyplegpkagpsrkpld eivhygkyqa
Timeline for d4dn2b_: