Lineage for d4dn2b_ (4dn2 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423301Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 1423302Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 1423411Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 1423412Protein automated matches [190672] (17 species)
    not a true protein
  7. 1423448Species Geobacter metallireducens [TaxId:269799] [226309] (1 PDB entry)
  8. 1423450Domain d4dn2b_: 4dn2 B: [219868]
    automated match to d3bema_
    complexed with fmn

Details for d4dn2b_

PDB Entry: 4dn2 (more details), 1.5 Å

PDB Description: crystal structure of putative nitroreductase from geobacter metallireducens gs-15
PDB Compounds: (B:) Nitroreductase

SCOPe Domain Sequences for d4dn2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dn2b_ d.90.1.0 (B:) automated matches {Geobacter metallireducens [TaxId: 269799]}
yfqsmetleairtrrsvrkfsdrpvepeklravldaarlapswanmqcwrfvvvedqatk
vqiselsyveayfgpkgyksnpaqkalaeapvviiacgeppqsgelrgqqyyltdvgiaa
qnlmlaahdlglgsvfvgvfdeqqlgellgipaelrivglfplgyplegpkagpsrkpld
eivhygkyqa

SCOPe Domain Coordinates for d4dn2b_:

Click to download the PDB-style file with coordinates for d4dn2b_.
(The format of our PDB-style files is described here.)

Timeline for d4dn2b_: