Lineage for d4dn2b1 (4dn2 B:1-186)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963484Species Geobacter metallireducens [TaxId:269799] [226309] (1 PDB entry)
  8. 2963486Domain d4dn2b1: 4dn2 B:1-186 [219868]
    Other proteins in same PDB: d4dn2a2, d4dn2b2
    automated match to d3bema_
    complexed with fmn

Details for d4dn2b1

PDB Entry: 4dn2 (more details), 1.5 Å

PDB Description: crystal structure of putative nitroreductase from geobacter metallireducens gs-15
PDB Compounds: (B:) Nitroreductase

SCOPe Domain Sequences for d4dn2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dn2b1 d.90.1.0 (B:1-186) automated matches {Geobacter metallireducens [TaxId: 269799]}
metleairtrrsvrkfsdrpvepeklravldaarlapswanmqcwrfvvvedqatkvqis
elsyveayfgpkgyksnpaqkalaeapvviiacgeppqsgelrgqqyyltdvgiaaqnlm
laahdlglgsvfvgvfdeqqlgellgipaelrivglfplgyplegpkagpsrkpldeivh
ygkyqa

SCOPe Domain Coordinates for d4dn2b1:

Click to download the PDB-style file with coordinates for d4dn2b1.
(The format of our PDB-style files is described here.)

Timeline for d4dn2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dn2b2