| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
| Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
| Protein automated matches [190672] (29 species) not a true protein |
| Species Geobacter metallireducens [TaxId:269799] [226309] (1 PDB entry) |
| Domain d4dn2a1: 4dn2 A:1-185 [219867] Other proteins in same PDB: d4dn2a2, d4dn2b2 automated match to d3bema_ complexed with fmn |
PDB Entry: 4dn2 (more details), 1.5 Å
SCOPe Domain Sequences for d4dn2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dn2a1 d.90.1.0 (A:1-185) automated matches {Geobacter metallireducens [TaxId: 269799]}
metleairtrrsvrkfsdrpvepeklravldaarlapswanmqcwrfvvvedqatkvqis
elsyveayfgpkgyksnpaqkalaeapvviiacgeppqsgelrgqqyyltdvgiaaqnlm
laahdlglgsvfvgvfdeqqlgellgipaelrivglfplgyplegpkagpsrkpldeivh
ygkyq
Timeline for d4dn2a1: