Lineage for d4dmwa_ (4dmw A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133953Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2133954Protein automated matches [190951] (26 species)
    not a true protein
  7. 2133982Species Clostridium difficile [TaxId:1496] [194953] (2 PDB entries)
  8. 2133984Domain d4dmwa_: 4dmw A: [219866]
    automated match to d4dmva_
    complexed with mn, udp

Details for d4dmwa_

PDB Entry: 4dmw (more details), 2.5 Å

PDB Description: Crystal structure of the GT domain of Clostridium difficile toxin A (TcdA) in complex with UDP and Manganese
PDB Compounds: (A:) Toxin A

SCOPe Domain Sequences for d4dmwa_:

Sequence, based on SEQRES records: (download)

>d4dmwa_ c.68.1.0 (A:) automated matches {Clostridium difficile [TaxId: 1496]}
sliskeeliklaysirpreneyktiltnldeynklttnnnenkylqlkklnesidvfmnk
yktssrnralsnlkkdilkeviliknsntspveknlhfvwiggevsdialeyikqwadin
aeyniklwydseaflvntlkkaivessttealqlleeeiqnpqfdnmkfykkrmefiydr
qkrfinyyksqinkptvptiddiikshlvseynrdetvlesyrtnslrkinsnhgidira
nslfteqellniysqellnrgnlaaasdivrllalknfggvyldvdmlpgihsdlfktis
rpssigldrwemikleaimkykkyinnytsenfdkldqqlkdnfkliiesksekseifsk
lenlnvsdleikiafalgsvinqaliskqgsyltnlvieqvknryqflnqhlnpaiesdn
nftdttkifhdslfnsataensmfltkiapylqvgfmpearstislsgpgayasayydfi
nlqentiektlkasdliefkfpennlsqlteqeinslwsfdqasakyqfekyvrdyt

Sequence, based on observed residues (ATOM records): (download)

>d4dmwa_ c.68.1.0 (A:) automated matches {Clostridium difficile [TaxId: 1496]}
sliskeeliklaysirpreneyktiltnldeynklttnnnenkylqlkklnesidvfmnk
yktssrnralsnlkkdilkeviliknsntspveknlhfvwiggevsdialeyikqwadin
aeyniklwydseaflvntlkkaivessttealqlleeeiqnpqfdnmkfykkrmefiydr
qkrfinyyksqinkvptiddiikshlvseynrdetvlesyrtnslrkinsnhgidirans
lfteqellniysqellnrgnlaaasdivrllalknfggvyldvdmlpgihsdlfktisrp
ssigldrwemikleaimkykkyinnytsenfdkldqqlkdnfkliiesksekseifskle
nlnvsdleikiafalgsvinqaliskqgsyltnlvieqvknryqflnqhlnpaiesdnnf
tdttkifhdslfnsataensmfltkiapylqvgfmpearstislsgpgayasayydfinl
qentiektlkasdliefkfpennlsqlteqeinslwsfdqasakyqfekyvrdyt

SCOPe Domain Coordinates for d4dmwa_:

Click to download the PDB-style file with coordinates for d4dmwa_.
(The format of our PDB-style files is described here.)

Timeline for d4dmwa_: