![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
![]() | Protein Retroviral integrase, catalytic domain [53108] (4 species) |
![]() | Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [267758] (4 PDB entries) |
![]() | Domain d4dmna_: 4dmn A: [219865] automated match to d4gw6a_ complexed with 0l9, ars, so4 |
PDB Entry: 4dmn (more details), 2.45 Å
SCOPe Domain Sequences for d4dmna_:
Sequence, based on SEQRES records: (download)
>d4dmna_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]} dcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvh tdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkt avqmavfihnkkrkggiggysagerivdiiatdiq
>d4dmna_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]} dcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvh tdngsnftsttvkaacwwagikqefgiesmnkelkkiigqvrdqaehlktavqmavfihn kkrkggiggysagerivdiiatdiq
Timeline for d4dmna_: