Lineage for d4dmlb_ (4dml B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2096035Species Synechococcus elongatus [TaxId:1140] [226307] (2 PDB entries)
  8. 2096041Domain d4dmlb_: 4dml B: [219858]
    automated match to d2rhcb_

Details for d4dmlb_

PDB Entry: 4dml (more details), 2.5 Å

PDB Description: 3-oxoacyl-[acyl-carrier-protein] reductase from Synechococcus elongatus PCC 7942
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d4dmlb_:

Sequence, based on SEQRES records: (download)

>d4dmlb_ c.2.1.0 (B:) automated matches {Synechococcus elongatus [TaxId: 1140]}
lpltdrialvtgasrgigraialelaaagakvavnyassagaadevvaaiaaaggeafav
kadvsqesevealfaavierwgrldvlvnnagitrdtlllrmkrddwqsvldlnlggvfl
csraaakimlkqrsgriiniasvvgemgnpgqanysaakagvigltktvakelasrgitv
navapgfiatdmtselaaeklleviplgrygeaaevagvvrflaadpaaayitgqvinid
gglvma

Sequence, based on observed residues (ATOM records): (download)

>d4dmlb_ c.2.1.0 (B:) automated matches {Synechococcus elongatus [TaxId: 1140]}
lpltdrialvtgasrgigraialelaaagakvavnyassagaadevvaaiaaaggeafav
kadvsqesevealfaavierwgrldvlvnnagitrdtlllrmkrddwqsvldlnlggvfl
csraaakimlkqrsgriiniasvvgemgnpgqanysaakagvigltktvakelasrgitv
navapgfiatdmtselaklleviplgrygeaaevagvvrflaadpaaayitgqvinidgg
lvma

SCOPe Domain Coordinates for d4dmlb_:

Click to download the PDB-style file with coordinates for d4dmlb_.
(The format of our PDB-style files is described here.)

Timeline for d4dmlb_: