SCOPe 2.08: Domain d4dllb2: 4dll B:191-318

Lineage for d4dllb2 (4dll B:191-318)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Polaromonas sp. [TaxId:296591] [226305] (1 PDB entry)

8. Domain d4dllb2: 4dll B:191-318 [219852]
   Other proteins in same PDB: d4dlla1, d4dllb1
   automated match to d1vpda1
   complexed with so4

Details for d4dllb2

PDB Entry: 4dll, 2.11 Å

PDB Description: Crystal structure of a 2-hydroxy-3-oxopropionate reductase from Polaromonas sp. JS666

PDB Compounds: (B:) 2-hydroxy-3-oxopropionate reductase

SCOPe Domain Sequences for d4dllb2:

Sequence; same for both SEQRES and ATOM records:

>d4dllb2 a.100.1.0 (B:191-318) automated matches {Polaromonas sp. [TaxId: 296591]}
phgsgqltklanqmivgitigavaeallfatkggadmakvkeaitggfadsrvlqlhgqr
mverdfaprarlsiqlkdmrnalataqeigfdapitglfeqlyaegvehgltdldqsglf
velasrng

Timeline for d4dllb2:

• d4dllb2 first appeared in SCOPe 2.03
  
• d4dllb2 appears in SCOPe 2.07