SCOPe 2.08: Domain d4dllb1: 4dll B:32-190

Lineage for d4dllb1 (4dll B:32-190)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Polaromonas sp. [TaxId:296591] [226304] (2 PDB entries)

8. Domain d4dllb1: 4dll B:32-190 [219851]
   Other proteins in same PDB: d4dlla2, d4dllb2
   automated match to d1vpda2
   complexed with so4

Details for d4dllb1

PDB Entry: 4dll, 2.11 Å

PDB Description: Crystal structure of a 2-hydroxy-3-oxopropionate reductase from Polaromonas sp. JS666

PDB Compounds: (B:) 2-hydroxy-3-oxopropionate reductase

SCOPe Domain Sequences for d4dllb1:

Sequence, based on SEQRES records:

>d4dllb1 c.2.1.0 (B:32-190) automated matches {Polaromonas sp. [TaxId: 296591]}
rkitflgtgsmglpmarrlceagyalqvwnrtparaaslaalgatiheqaraaardadiv
vsmlengavvqdvlfaqgvaaamkpgslfldmasitpreardhaarlgalgiahldtpvs
ggtvgaeqgtlvimaggkpadferslpllkvfgrathvg

Sequence, based on observed residues (ATOM records):

>d4dllb1 c.2.1.0 (B:32-190) automated matches {Polaromonas sp. [TaxId: 296591]}
rkitflgtmglpmarrlceagyalqvwnrtparaaslaalgatiheqaraaardadivvs
mlengavvqdvlfaqgvaaamkpgslfldmasitpreardhaarlgalgiahldtpvsgg
tvgaeqgtlvimaggkpadferslpllkvfgrathvg

Timeline for d4dllb1:

• d4dllb1 first appeared in SCOPe 2.03
  
• d4dllb1 appears in SCOPe 2.07