Lineage for d4dlla2 (4dll A:191-316)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721902Species Polaromonas sp. [TaxId:296591] [226305] (1 PDB entry)
  8. 2721903Domain d4dlla2: 4dll A:191-316 [219850]
    Other proteins in same PDB: d4dlla1, d4dllb1
    automated match to d1vpda1
    complexed with so4

Details for d4dlla2

PDB Entry: 4dll (more details), 2.11 Å

PDB Description: Crystal structure of a 2-hydroxy-3-oxopropionate reductase from Polaromonas sp. JS666
PDB Compounds: (A:) 2-hydroxy-3-oxopropionate reductase

SCOPe Domain Sequences for d4dlla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dlla2 a.100.1.0 (A:191-316) automated matches {Polaromonas sp. [TaxId: 296591]}
phgsgqltklanqmivgitigavaeallfatkggadmakvkeaitggfadsrvlqlhgqr
mverdfaprarlsiqlkdmrnalataqeigfdapitglfeqlyaegvehgltdldqsglf
velasr

SCOPe Domain Coordinates for d4dlla2:

Click to download the PDB-style file with coordinates for d4dlla2.
(The format of our PDB-style files is described here.)

Timeline for d4dlla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dlla1