| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Polaromonas sp. [TaxId:296591] [226305] (1 PDB entry) |
| Domain d4dlla2: 4dll A:191-316 [219850] Other proteins in same PDB: d4dlla1, d4dllb1 automated match to d1vpda1 complexed with so4 |
PDB Entry: 4dll (more details), 2.11 Å
SCOPe Domain Sequences for d4dlla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dlla2 a.100.1.0 (A:191-316) automated matches {Polaromonas sp. [TaxId: 296591]}
phgsgqltklanqmivgitigavaeallfatkggadmakvkeaitggfadsrvlqlhgqr
mverdfaprarlsiqlkdmrnalataqeigfdapitglfeqlyaegvehgltdldqsglf
velasr
Timeline for d4dlla2: