Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (17 species) not a true protein |
Species Branchiostoma floridae [TaxId:7739] [226665] (2 PDB entries) |
Domain d4dknb_: 4dkn B: [219842] automated match to d2c9ja_ |
PDB Entry: 4dkn (more details), 1.35 Å
SCOPe Domain Sequences for d4dknb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dknb_ d.22.1.0 (B:) automated matches {Branchiostoma floridae [TaxId: 7739]} plpathdihlhgsinghefdmvgggkgdpnagslvttakstkgalkfspylmiphlgygy yqylpypdgpspfqvsmlegsgyavyrvfdfedggklstefkysyegshikadmklmgsg fpddgpvmtsqivdqdgcvskktylnnntivdsfdwsynlqngkryrarvsshyifdkpf sadlmkkqpvfvyrkchvkatktevtlderekafyel
Timeline for d4dknb_: