SCOPe 2.03: Domain d4dknb_: 4dkn B:

Lineage for d4dknb_ (4dkn B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (17 species)
   not a true protein

7. Species Branchiostoma floridae [TaxId:7739] [226665] (2 PDB entries)

8. Domain d4dknb_: 4dkn B: [219842]
   automated match to d2c9ja_

Details for d4dknb_

PDB Entry: 4dkn, 1.35 Å

PDB Description: crystal structure of amphioxus green fluorescent protein, gfpa1

PDB Compounds: (B:) amphioxus green fluorescent protein, gfpa1

SCOPe Domain Sequences for d4dknb_:

Sequence; same for both SEQRES and ATOM records:

>d4dknb_ d.22.1.0 (B:) automated matches {Branchiostoma floridae [TaxId: 7739]}
plpathdihlhgsinghefdmvgggkgdpnagslvttakstkgalkfspylmiphlgygy
yqylpypdgpspfqvsmlegsgyavyrvfdfedggklstefkysyegshikadmklmgsg
fpddgpvmtsqivdqdgcvskktylnnntivdsfdwsynlqngkryrarvsshyifdkpf
sadlmkkqpvfvyrkchvkatktevtlderekafyel

Timeline for d4dknb_:

• d4dknb_ is new in SCOPe 2.03-stable
  
• d4dknb_ appears in SCOPe 2.04
  
• d4dknb_ appears in the current release, SCOPe 2.08